<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="fi">
	<id>http://www.harrika.fi/wiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=J8kesio729</id>
	<title>Motopedia - Käyttäjän muokkaukset [fi]</title>
	<link rel="self" type="application/atom+xml" href="http://www.harrika.fi/wiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=J8kesio729"/>
	<link rel="alternate" type="text/html" href="http://www.harrika.fi/wiki/index.php?title=Toiminnot:Muokkaukset/J8kesio729"/>
	<updated>2026-09-08T00:10:48Z</updated>
	<subtitle>Käyttäjän muokkaukset</subtitle>
	<generator>MediaWiki 1.38.6</generator>
	<entry>
		<id>http://www.harrika.fi/wiki/index.php?title=Supercharging_FTO_Search_with_Degenerate_Sequence_Searching_39925&amp;diff=171859</id>
		<title>Supercharging FTO Search with Degenerate Sequence Searching 39925</title>
		<link rel="alternate" type="text/html" href="http://www.harrika.fi/wiki/index.php?title=Supercharging_FTO_Search_with_Degenerate_Sequence_Searching_39925&amp;diff=171859"/>
		<updated>2023-07-24T12:27:44Z</updated>

		<summary type="html">&lt;p&gt;J8kesio729: Ak: Uusi sivu: Biological sequences variety the bedrock of innovation in biotechnology, with countless advancements revolving all around these sequences. Nonetheless, the special mother nature of biological sequences poses a challenge for conventional keyword-centered details retrieval approaches, frequently bringing about the oversight of very important information and facts and probable risks.  The sequences introduced in patent promises encompass a wide range of variations, don't just de...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Biological sequences variety the bedrock of innovation in biotechnology, with countless advancements revolving all around these sequences. Nonetheless, the special mother nature of biological sequences poses a challenge for conventional keyword-centered details retrieval approaches, frequently bringing about the oversight of very important information and facts and probable risks.&lt;br /&gt;
&lt;br /&gt;
The sequences introduced in patent promises encompass a wide range of variations, don't just describing the sequences them selves but also necessitating a specific volume of homology. Due to this [https://eureka.patsnap.com/patent-CN111736576A Left shifting] fact, researchers heavily count on homology sequence alignment algorithms to examine sequence databases, using predefined homology thresholds to make certain in depth benefits. This method is commonly employed in current Organic sequence database queries.&lt;br /&gt;
&lt;br /&gt;
Yet, a pressing problem remains: can these identical sequence searches genuinely detect all potential target sequences? Though these solutions have demonstrated powerful, their capability to [https://eureka.patsnap.com/patent-US6905218B2 Easy to customize] capture every pertinent sequence warrants additional examination. It is actually very important to examine the limitations of existing look for methodologies and try for Improved methods that go away no likely target sequence undiscovered.  &lt;br /&gt;
&lt;br /&gt;
Special Sequences in Patents  &lt;br /&gt;
&lt;br /&gt;
Combining comparable sequence lookups with search phrase centered success aggregation significantly lowers the risk of overlooking essential details and FTO troubles.&lt;br /&gt;
&lt;br /&gt;
However, sequences in patents differ from These found in other Organic databases [https://eureka.patsnap.com/patent-CN107630413A Pressure temperature] as they exhibit quite a few [https://eureka.patsnap.com/patent-CN102185919A Muscle activity] “patent-distinct” properties. To develop the scope of patent protection and develop research limitations for competition, patent drafters normally utilize an outline technique just like the “Markush composition” Employed in chemistry. By introducing degenerate symbols, wildcards, operators, along with other facts among positions inside the mother or father sequence, and describing the particular parameters of such symbols through explanatory files, we confer with them as “Degenerate Sequences.”&lt;br /&gt;
&lt;br /&gt;
The image down below illustrates a degenerate sequence described in patent promises:  &lt;br /&gt;
&lt;br /&gt;
Degenerate sequences on their own will not possess any Organic importance; they only serve the objective of the patent. On the other hand, when coupled with the description from the homology range, these kinds of an technique not simply comprehensively protects innovative achievements but additionally turns into a “decisive blow” from The present traditional sequence homology look for solutions.  Allow’s Consider an case in point below.&lt;br /&gt;
&lt;br /&gt;
Question sequence:&lt;br /&gt;
&lt;br /&gt;
“EVGSYPAPSDACPSDYFYCDASGRSAGGGGTENLYFQGSGGS”  &lt;br /&gt;
&lt;br /&gt;
Target sequence:  &lt;br /&gt;
&lt;br /&gt;
“EVGSYXXXXXXCXXXXXXCXXSGRSAGGGG TENLYFQGSG GS”  &lt;br /&gt;
&lt;br /&gt;
The similarity rating received from the BLAST algorithm is simply sixty seven%, but the particular similarity is one hundred%.  &lt;br /&gt;
&lt;br /&gt;
This comes about simply because common sequence homology alignment algorithms never take into consideration eventualities involving degenerate sequences throughout their Original improvement. Therefore, without having special processing, excluding degenerate sequences would bring about two situations when employing typical algorithms:  &lt;br /&gt;
&lt;br /&gt;
1) Incapacity to look for the sequence &lt;br /&gt;
&lt;br /&gt;
2) Exclusion of sequences as a consequence of similarity scores falling underneath the threshold.  &lt;br /&gt;
&lt;br /&gt;
Equally scenarios pose considerable problems for sequence searchers, because they don't just impede the comparison of sequences with patent claims but will also increase the probability of overlooking crucial sequence info.  &lt;br /&gt;
&lt;br /&gt;
Patsnap’s Resolution &lt;br /&gt;
&lt;br /&gt;
Patsnap’s Organic sequence database (Bio) data demonstrate which the occurrence of these types of Particular sequences in global patent literature is not insignificant. There are roughly 7.4 million nucleotide sequences, accounting for seven.12% of the entire amount of nucleotides, and 1.31 million protein sequences, accounting for seven.fifty five%. This indicates a major variety of generic sequences which will have an effect on search results due to the existence of Exclusive symbols, [https://eureka.patsnap.com/patent-CN113917292A Increase illumination] posing considerable threats for FTO analyses.  &lt;br /&gt;
&lt;br /&gt;
As a result, to mitigate the risk of overlooking these crucial sequences, Patsnap’s Algorithm Engineering Crew has formulated a deep Understanding product utilizing in-household NLP, CV, entity recognition, and coreference resolution systems.&lt;br /&gt;
&lt;br /&gt;
This design is designed to determine and parse degenerate sequences and their substitutions in sequence listings and entire-textual content patents, and it proven a Degenerate Sequence Seeking Databases as Element of our Bio Qualified bundle.&lt;br /&gt;
&lt;br /&gt;
Employing a specialized sequence alignment algorithm, this databases not just permits the retrieval of these kinds of sequences but will also delivers a real similarity score. As a result, by carrying out lookups within the degenerate sequence databases, we can properly mitigate the potential risk of inadvertently overlooking important information all through freedom to work (FTO) and novelty queries. &lt;br /&gt;
&lt;br /&gt;
Offered the likely scale of variants in degenerate sequences, which might get to the tens of billions, common sequence alignment algorithms fail to fulfill the real-time retrieval requires. Patsnap tackles this challenge by utilizing a deeply tailored sequence alignment algorithm that dynamically masses substitution data for degenerate sequences through the retrieval method, making sure specific retrieval inside acceptable time frames.&lt;br /&gt;
&lt;br /&gt;
In the scanning stage, Patsnap introduces a compression algorithm to build a seed term table for heuristic lookups, noticeably decreasing unwanted comparisons and increasing retrieval performance. When aligning question sequences with goal sequences, Patsnap’s proprietary algorithm incorporates degenerate substitution information and facts, resulting in additional correct alignment and query success, in addition to far more intuitive and visually attractive alignment outcomes for various variants of the query sequence and target sequence. &lt;br /&gt;
&lt;br /&gt;
Encounter Degenerate Sequence Browsing Now &lt;br /&gt;
&lt;br /&gt;
In June of 2023, Patsnap’s Organic sequence Bio databases introduced a strong degenerate sequence research function, creating a paradigm shift inside the patent domain. This disruptive progression provides scientists with the immensely robust Instrument that offers an extensive assortment of degenerate sequences, permitting end users to effortlessly attain by far the most accurate and relevant data in their lookups. &lt;br /&gt;
&lt;br /&gt;
To program a demo or find out more, stop by patsnap.com/alternatives/bio.&lt;br /&gt;
&lt;br /&gt;
About Patsnap: Established in 2007, Patsnap is the corporation at the rear of the globe’s main AI-run innovation intelligence System. Patsnap provides world-wide enterprises that has a connected, easy-to-use platform that assists them make better selections during the innovation process. Buyers are innovators throughout many marketplace sectors, together with agriculture and chemical substances, client products, foodstuff and beverage, life sciences, automotive, oil and gasoline, Specialist providers, aviation and aerospace, and education.&lt;/div&gt;</summary>
		<author><name>J8kesio729</name></author>
	</entry>
</feed>